PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1670s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family TALE
Protein Properties Length: 293aa    MW: 33000.1 Da    PI: 6.5649
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1670s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.71.7e-072422742254
                          SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           +yp+++++++L +++gL+ +q+ +WF N+R +
  Cagra.1670s0003.1.p 242 WPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 274
                          58*****************************87 PP

2ELK22.72.3e-08195216122
                  ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                          ELK +L++++++++ ++++E++
  Cagra.1670s0003.1.p 195 ELKLELKQGFKSRIEDVREEIM 216
                          9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.2E-192771IPR005540KNOX1
PfamPF037901.1E-162970IPR005540KNOX1
SMARTSM012562.0E-2581136IPR005541KNOX2
PfamPF037913.4E-1985135IPR005541KNOX2
PROSITE profilePS512139.202195215IPR005539ELK domain
PROSITE profilePS5007111.823215278IPR001356Homeobox domain
SuperFamilySSF466892.48E-16217281IPR009057Homeodomain-like
SMARTSM003896.3E-11217282IPR001356Homeobox domain
CDDcd000863.61E-12218279No hitNo description
Gene3DG3DSA:1.10.10.605.0E-25222280IPR009057Homeodomain-like
PfamPF059203.2E-18235274IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MQEAALGMIG GTVGGDGDAV AAAEQNRQMK GEIATHPMYE QLLAAHVSCL RVATPIDQLP  60
IIEAQLSQSH HLLRSYASTA VGYSHHDRHE LDNFLAQYVM VLCSFKEQLQ QHVRVHAVEA  120
VMACREIENN LHSLTGATLG EGSGATMSED EDDLQMDFSS DNSGVDFSGS HDMTGFGPLL  180
PTESERSLME RVRQELKLEL KQGFKSRIED VREEIMRKRR AGKLPGDTTT VLKNWWQQHC  240
KWPYPTEDDK AKLVEETGLQ LKQINNWFIN QRKRNWHNNS HSLTSLKSKR KH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A4e-13218274864Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3084510.0AF308451.1 Arabidopsis thaliana homeodomain transcription factor KNAT7 (KNAT7) mRNA, complete cds.
GenBankBT0260590.0BT026059.1 Arabidopsis thaliana At1g62990 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006302629.10.0hypothetical protein CARUB_v10020735mg
SwissprotQ9FPQ80.0KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLR0GI400.0R0GI40_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__183__AT1G62990.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.10.0KNOTTED-like homeobox of Arabidopsis thaliana 7